PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0626s0210.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 335aa    MW: 38005.4 Da    PI: 5.6998
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0626s0210.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.91.5e-072853172254
                             SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              +yp++e++++L +++gL+ +q+ +WF N+R +
  SapurV1A.0626s0210.1.p 285 WPYPTEEDKARLVQETGLQLKQINNWFINQRKR 317
                             69*****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.2E-1673117IPR005540KNOX1
PfamPF037907.3E-1775116IPR005540KNOX1
SMARTSM012561.2E-25126181IPR005541KNOX2
PfamPF037919.1E-18130180IPR005541KNOX2
PROSITE profilePS512139.167238258IPR005539ELK domain
PROSITE profilePS5007111.58258321IPR001356Homeobox domain
SMARTSM003891.9E-10260325IPR001356Homeobox domain
SuperFamilySSF466895.99E-16260322IPR009057Homeodomain-like
CDDcd000862.38E-11261320No hitNo description
Gene3DG3DSA:1.10.10.601.4E-24265321IPR009057Homeodomain-like
PfamPF059201.4E-17278317IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MAFEDQHHIP QEMAFQLPHH HLSASSSTGP TWLSNAILRR NDDFMTIEKP ENNANNGSEE  60
ELVDSVSDNW ERVKCKADIL GHPFYEQLLA AHVACLRIAT PVDQLARIDT QLAQSQDVVA  120
KYSGVGSGHV VDEKELDQFM THYALLLCAF KDQLQQHVRV HAMEAVMACW ELEQSLQSLT  180
GVSPGEGTGA TMSDDDDDQA ESDTNLYDGN LDGLDSMGFG PLVPTETERS LMERVRQELK  240
HEFKQDYKEK IVDIREEILR KRRAGKLPGD TTSHLKAWWQ THSKWPYPTE EDKARLVQET  300
GLQLKQINNW FINQRKRNWH SSPSGSSSKS KRKK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1314333RKRNWHSSPSGSSSKSKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7699990.0KP769999.1 Populus tomentosa Homeobox protein knotted-1-like 3 (Potri.006G190000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002324571.20.0hypothetical protein POPTR_0018s12200g
SwissprotP480001e-162KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLB9IMJ90.0B9IMJ9_POPTR; Uncharacterized protein
STRINGPOPTR_0018s12200.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-155KNOTTED1-like homeobox gene 3